The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1H, 15N and 13C resonance assignments of the putative Bet v 1 family protein At1g24000.1 from Arabidopsis thaliana. J.Biomol.Nmr 32 335-335 2005
    Site CESG
    PDB Id 1vjh Target Id GO.5358
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30336, Molecular Weight 13801.20 Da.
    Residues 122 Isoelectric Point 6.42
    Sequence mtlkgalsvkfdvkcpadkffsafvedtnrpfekngkteieavdlvkktmtiqmsgseiqkyfktlkgs iavtpigvgdgshvvwtfhfekvhkdiddphsiidesvkyfkkldeailnfke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2392
    Matthews' coefficent 2.22 Rfactor 0.1857
    Waters 106 Solvent Content 44.49

    Ligand Information


    Google Scholar output for 1vjh

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch