The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of a single-domain thiosulfate sulfurtransferase from Arabidopsis thaliana. Protein Sci. 15 2836-2841 2006
    Site CESG
    PDB Id 1tq1 Target Id GO.20862
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30284,6240 Molecular Weight 12675.53 Da.
    Residues 120 Isoelectric Point 6.49
    Sequence maeesrvpssvsvtvahdlllaghryldvrtpeefsqghacgainvpymnrgasgmsknpdfleqvssh fgqsdniivgcqsggrsikattdllhagftgvkdivggysawaknglptka
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1tq1

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch