The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Cell-free protein production and labeling protocol for NMR-based structural proteomics. Nat.Methods 1 149-153 2004
    Site CESG
    PDB Id 1se9 Target Id GO.15176
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30329,6128 Molecular Weight 12820.25 Da.
    Residues 117 Isoelectric Point 9.10
    Sequence maevhnqleikfrltdgsdigpkafpdattvsalketvisewprekengpktvkevklisagkvlensk tvkdyrspvsnlagavttmhviiqapvtekekkpkgdpkmnkcvcsvm
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1se9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch