.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rjj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of a homodimeric hypothetical protein, at5g22580, a structural genomics target from Arabidopsis thaliana. J.Biomol.Nmr 29 387-390 2004
    Site CESG
    PDB Id 1rjj Target Id GO.22997
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30354,6011 Molecular Weight 12348.49 Da.
    Residues 111 Isoelectric Point 5.42
    Sequence matsgfkhlvvvkfkedtkvdeilkglenlvsqidtvksfewgedkeshdmlrqgfthafsmtfenkdg yvaftshplhvefsaaftavidkivlldfpvaavkssvvatp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1rjj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch