.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q4r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the protein from gene At3g17210 of Arabidopsis thaliana. Proteins 57 218-220 2004
    Site CESG
    PDB Id 1q4r Target Id GO.13081
    Related PDB Ids 1q53 
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30302,5843 Molecular Weight 12183.36 Da.
    Residues 109 Isoelectric Point 5.42
    Sequence meeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlhqgythifestfe skeavaeyiahpahvefatiflgsldkvlvidykptsvsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.2323
    Matthews' coefficent 1.95 Rfactor 0.18217
    Waters 109 Solvent Content 36.50

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1q4r

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch