The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of At2g03760, a putative steroid sulfotransferase from Arabidopsis thaliana. Proteins 57 854-857 2004
    Site CESG
    PDB Id 1q44 Target Id GO.7312
    Molecular Characteristics
    Source Arabidopsis thaliana columbia
    Alias Ids TPS30268, Molecular Weight 37137.42 Da.
    Residues 326 Isoelectric Point 5.36
    Sequence msssssvpaylgdedltqetralisslpkekgwlvseiyefqglwhtqailqgilicqkrfeakdsdii lvtnpksgttwlkalvfallnrhkfpvsssgnhpllvtnphllvpflegvyyespdfdfsslpsprlmn thishlslpesvksssckivyccrnpkdmfvslwhfgkklapeetadypiekaveafcegkfiggpfwd hileywyasrenpnkvlfvtyeelkkqtevemkriaeflecgfieeeevreivklcsfeslsnlevnke gklpngietktffrkgeiggwrdtlseslaeeidrtieekfkgsglkfss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.22171
    Matthews' coefficent 2.89 Rfactor 0.19147
    Waters 214 Solvent Content 57.20

    Ligand Information
    Ligands MLA (MALONIC) x 1


    Google Scholar output for 1q44

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch