The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and function of the glycopeptide N-methyltransferase MtfA, a tool for the biosynthesis of modified glycopeptide antibiotics. Chem.Biol. 16 401-410 2009
    Site BSGI
    PDB Id 3g2q Target Id MTFA_AMYOR
    Molecular Characteristics
    Source Amycolatopsis orientalis
    Alias Ids TPS26956, Molecular Weight 30484.71 Da.
    Residues 280 Isoelectric Point 5.05
    Sequence msnqlergpvrtphadvllasvgergvlcdfydegaadtyrdliqdadgtsearefatrtgpvsgpvle laagmgrltfpfldlgwevtalelstsvlaafrkrlaeapadvrdrctlvqgdmsafaldkrfgtvvis sgsineldeadrrglyasvrehlepggkfllslamseaaeseplerkqelpgrsgrryvlhvrhlpaee iqeitihpadettdpfvvcthrrrllapdqvvrelvrsgfdviaqtpfasggagrkdmvlveavmpgat adar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.18 Rfree 0.253
    Matthews' coefficent 2.55 Rfactor 0.226
    Waters 124 Solvent Content 51.77

    Ligand Information


    Google Scholar output for 3g2q

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch