.
The Open Protein Structure Annotation Network
PDB Keyword
.

3g05

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure-function analysis of Escherichia coli MnmG (GidA), a highly conserved tRNA-modifying enzyme. J.Bacteriol. 191 7614-7619 2009
    Site BSGI
    PDB Id 3g05 Target Id MNMG_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS26958, Molecular Weight 69561.50 Da.
    Residues 629 Isoelectric Point 6.08
    Sequence mfypdpfdviiiggghagteaamaaarmgqqtlllthnidtlgqmscnpaiggigkghlvkevdalggl makaidqagiqfrilnaskgpavratraqadrvlyrqavrtalenqpnlmifqqavedlivendrvvga vtqmglkfrakavvltvgtfldgkihigldnysggragdppsiplsrrlrelplrvgrlktgtpprida rtidfsvlaqqhgdnpmpvfsfmgnasqhpqqvpcyithtnekthdvirsnldrspmyagviegvgpry cpsiedkvmrfadrnqhqiflepegltsneiypngistslpfdvqmqivrsmqgmenakivrpgyaiey dffdprdlkptleskfiqglffagqingttgyeeaaaqgllaglnaarlsddkegwaparsqaylgvlv ddlctlgtkepyrmftsraeyrlmlrednadlrlteigrelglvdderwarfnekleniererqrlkst wvtpsaeaaaevnahltaplsreasgedllrrpemtyeklttltpfapaltdeqaaeqveiqvkyegyi arqqdeiekqlrnentllpatldyrqvsglsneviaklndhkpasigqasrisgvtpaaisillvwlkkqgmlrrsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 3.49 Rfree 0.265
    Matthews' coefficent 6.39 Rfactor 0.227
    Waters Solvent Content 80.80

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     
    Google Scholar output for 3g05

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch