.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b8o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Nat.Struct.Mol.Biol. 15 130-138 2008
    Site BSGI
    PDB Id 3b8o Target Id WZZE_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11995, Molecular Weight 39618.17 Da.
    Residues 349 Isoelectric Point 6.25
    Sequence mmtqpmpgkpaedaeneldirglfrtlwagklwiigmglafalialaytffarqewsstaitdrptvnm lggyysqqqflrnldvrsnmasadqpsvmdeaykefvmqlaswdtrrefwlqtdyykqrmvgnskadaa lldeminniqfipgdftravndsvkliaetapdannllrqyvafasqraashlndelkgawaartiqmk aqvkrqeevakaiydrrmnsieqalkiaeqhnisrsatdvpaeelpdsemfllgrpmlqarlenlqavg pafdldydqnramlntlnvgptldprfqtyrylrtpeepvkrdsprraflmimwgivggligagvaltrrcsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.40 Rfree 0.26562
    Matthews' coefficent 2.82 Rfactor 0.22333
    Waters 395 Solvent Content 56.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3b8o

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch