.
The Open Protein Structure Annotation Network
PDB Keyword
.

3b8n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Bacterial polysaccharide co-polymerases share a common framework for control of polymer length. Nat.Struct.Mol.Biol. 15 130-138 2008
    Site BSGI
    PDB Id 3b8n Target Id FEPE_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11980, Molecular Weight 42132.29 Da.
    Residues 377 Isoelectric Point 6.08
    Sequence msslnikqgsdahfpdyplaspsnneidllnlisvlwrakktvmavvfafacagllisfilpqkwtsaa vvtppepvqwqelektftklrvldldikidrteafnlfikkfqsvslleeylrsspyvmdqlkeakide ldlhraivalsekmkavddnaskkkdepslytswtlsftaptseeaqtvlsgyidyisalvvkesienv rnkleiktqfekeklaqdrikmknqldaniqrlnysldianaagikkpvysngqavkddpdfsislgad gierkleiekavtdvaelngelrnrqylveqltkanindvnftpfkyqlspslpvkkdgpgkaiivils aliggmvacgsvllryamasrkqdammadhlv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 9
    Resolution (Å) 3.10 Rfree 0.282
    Matthews' coefficent 3.61 Rfactor 0.254
    Waters Solvent Content 70.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3b8n

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch