.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r1a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Novel structure of the conserved gram-negative lipopolysaccharide transport protein A and mutagenesis analysis. J.Mol.Biol. 380 476-488 2008
    Site BSGI
    PDB Id 2r1a Target Id YHBN_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11973, Molecular Weight 20125.93 Da.
    Residues 185 Isoelectric Point 8.96
    Sequence mkfktnklslnlvlassllaasipafavtgdtdqpihiesdqqsldmqgnvvtftgnvivtqgtikina dkvvvtrpggeqgkevidgygkpatfyqmqdngkpveghasqmhyelakdfvvltgnaylqqvdsnikg dkitylvkeqkmqafsdkgkrvttvlvpsqlqdknnkgqtpaqkkgn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 7
    Resolution (Å) 3.26 Rfree 0.36086
    Matthews' coefficent 4.14 Rfactor 0.29801
    Waters 68 Solvent Content 70.32

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2r1a

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch