.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ozn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural basis of Clostridium perfringens toxin complex formation. Proc.Natl.Acad.Sci.Usa 105 12194-12199 2008
    Site BSGI
    PDB Id 2ozn Target Id FivarDoc
    Molecular Characteristics
    Source Clostridium perfringens
    Alias Ids TPS11937, Molecular Weight 15489.17 Da.
    Residues 140 Isoelectric Point 4.70
    Sequence mdktnlgelinqgkslldesvegfnvgeyhkgakdgltveinkaeevfnkedateeeinlakeslegai arfnsllieestgdfngngkidigdlamvsknigsttntsldlnkdgsideyeisfinhrilnlehhhh hh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.24562
    Matthews' coefficent 1.90 Rfactor 0.20408
    Waters 315 Solvent Content 35.29

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1;CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 2ozn

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch