The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of [NiFe] hydrogenase maturation protein HypE from Escherichia coli and its interaction with HypF. J.Bacteriol. 190 1447-1458 2008
    Site BSGI
    PDB Id 2i6r Target Id HYPE_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11989, Molecular Weight 33735.96 Da.
    Residues 322 Isoelectric Point 4.97
    Sequence mqqlinslfmeafanpwlaeqedqarldlaqlvaegdrlafstdsyvidplffpggnigklaicgtand vavsgaiprylscgfileeglpmetlkavvtsmaetartagiaivtgdtkvvqrgaadklfintagmga iptnihwgaqtltagdillvsgtlgdhgatilnlreqlgldgelvsdcavltpliqtlrdipgvkalrd atrggvnavvhexaaacgcgieisesalpvkpavrgvcellgldalnfanegklviavernaaeqvlaa lhshplgkdaaligevverkgvrlaglygvkrtldlphaeplpric
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.51 Rfree 0.24
    Matthews' coefficent 3.33 Rfactor 0.193
    Waters 397 Solvent Content 63.03

    Ligand Information


    Google Scholar output for 2i6r

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch