The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of YcgL, a conserved protein from Escherichia coli representing the DUF709 family, with a novel alpha/beta/alpha sandwich fold. Proteins 66 1004-1007 2007
    Site BSGI
    PDB Id 2h7a Target Id YCGL_ECOL6
    Molecular Characteristics
    Source Escherichia coli cft073
    Alias Ids TPS11932, Molecular Weight 12413.89 Da.
    Residues 108 Isoelectric Point 9.16
    Sequence mpkpgilksksmfcviyrsskrdqtylyvekkddfsrvpeelmkgfgqpqlamilpldgrkklvnadie kvkqalteqgyylqlppppedllkqhlsvmgqktddtnk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2h7a

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch