The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural snapshots of Escherichia coli histidinol phosphate phosphatase along the reaction pathway. J.Biol.Chem. 281 37930-37941 2006
    Site BSGI
    PDB Id 2fpu Target Id HIS7_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11983, Molecular Weight 40419.10 Da.
    Residues 356 Isoelectric Point 5.86
    Sequence mmsqkylfidrdgtliseppsdfqvdrfdklafepgvipqllklqkagyklvmitnqdglgtqsfpqad fdgphnlmmqiftsqgvqfdevlicphlpadecdcrkpkvklverylaeqamdransyvigdratdiql aenmginglrydretlnwpmigeqltrrdryahvvrntketqidvqvwldreggskintgvgffdhmld qiathggfrmeinvkgdlyiddhhtvedtglalgealkialgdkrgicrfgfvlpmdeclarcaldisg rphleykaeftyqrvgdlstemiehffrslsytmgvtlhlktkgkndhhrveslfkafgrtlrqairve gdtlpsskgvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.22296
    Matthews' coefficent 2.52 Rfactor 0.18349
    Waters 481 Solvent Content 51.24

    Ligand Information
    Ligands HSO (HISTIDINOL) x 1
    Metals CL (CHLORIDE) x 4;ZN (ZINC) x 2;MG (MAGNESIUM) x 2


    Google Scholar output for 2fpu

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch