.
The Open Protein Structure Annotation Network
PDB Keyword
.

2amj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Modulator of drug activity B from Escherichia coli: crystal structure of a prokaryotic homologue of DT-diaphorase. J.Mol.Biol. 359 455-465 2006
    Site BSGI
    PDB Id 2amj Target Id MDAB_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11991, Molecular Weight 21889.85 Da.
    Residues 193 Isoelectric Point 5.85
    Sequence msniliingakkfahsngqlndtltevadgtlrdlghdvrivradsdydvkaevqnflwadvviwqmpg wwmgapwtvkkyiddvfteghgtlyasdgrtrkdpskkygsgglvqgkkymlsltwnapmeaftekdqf fhgvgvdgvylpfhkanqflgmeplptfiandvikmpdvpryteeyrkhlveifg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.263
    Matthews' coefficent 2.20 Rfactor 0.233
    Waters 586 Solvent Content 42.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2amj

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch