.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zyl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a novel prokaryotic Ser/Thr kinase and its implication in the Cpx stress response pathway. Mol.Microbiol. 63 1360-1371 2007
    Site BSGI
    PDB Id 1zyl Target Id RDOA_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11975, Molecular Weight 38118.37 Da.
    Residues 328 Isoelectric Point 4.99
    Sequence mnnsaftfqtlhpdtimdalfehgirvdsgltplnsyenrvyqfqdedrrrfvvkfyrperwtadqile ehqfalqlvndevpvaapvafngqtllnhqgfyfavfpsvggrqfeadnidqmeavgrylgrmhqtgrk qlfihrptiglneylieprklfedatlipsglkaaflkatdeliaavtahwredftvlrlhgdchagni lwrdgpmfvdlddarngpavqdlwmllngdkaeqrmqletiieayeefsefdtaeiglieplramrlvy ylawlmrrwadpafpknfpwltgedywlrqtatfieqakvlqepplqltpmy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.279
    Matthews' coefficent 2.90 Rfactor 0.215
    Waters Solvent Content 56.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1zyl

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch