The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ureidoglycolate hydrolase (AllA) from Escherichia coli O157:H7. Proteins 61 454-459 2005
    Site BSGI
    PDB Id 1yqc Target Id ALLA_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11979, Molecular Weight 18221.67 Da.
    Residues 160 Isoelectric Point 4.90
    Sequence mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdrtlisinraqpanlpltih elerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhrnvwhhplfawqrvtdflt idrggsdncdvesipeqelcfa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.71 Rfree 0.269
    Matthews' coefficent 2.18 Rfactor 0.2262
    Waters 319 Solvent Content 43.00

    Ligand Information
    Ligands GLV (GLYOXYLIC) x 1


    Google Scholar output for 1yqc

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch