.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y00

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the carbon storage regulator protein CsrA from Escherichia coli. J.Bacteriol. 187 3496-3501 2005
    Site BSGI
    PDB Id 1y00 Target Id CSRA_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11936, Molecular Weight 6855.58 Da.
    Residues 61 Isoelectric Point 8.16
    Sequence mliltrrvgetlmigdevtvtvlgvkgnqvrigvnapkevsvhreeiyqriqaeksqqssy
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 2

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1y00

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch