.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xzo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Identification of a Disulfide Switch in BsSco, a Member of the Sco Family of Cytochrome c Oxidase Assembly Proteins. Biochemistry 44 2934-2942 2005
    Site BSGI
    PDB Id 1xzo Target Id YPMQ_BACSU
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS11978, Molecular Weight 21644.58 Da.
    Residues 193 Isoelectric Point 5.00
    Sequence mkvikgltagliflflcacggqqikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticp pmtahmtdlqkklkagnidvriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalks fkaivkkpegedqvihqssfylvgpdgkvlkdyngventpyddiisdvksastlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.28935
    Matthews' coefficent 3.12 Rfactor 0.23824
    Waters 388 Solvent Content 60.30

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 14;CD (CADMIUM) x 5

    Jmol

     
    Google Scholar output for 1xzo

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch