The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and biochemical analysis reveal pirins to possess quercetinase activity. J.Biol.Chem. 280 28675-28682 2005
    Site BSGI
    PDB Id 1tq5 Target Id YHHW_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11974, Molecular Weight 26278.09 Da.
    Residues 231 Isoelectric Point 5.21
    Sequence miylrkanerghanhgwldswhtfsfanyydpnfmgfsalrvinddvieagqgfgthphkdmeiltyvl egtvehqdsmgnkeqvpagefqimsagtgirhseynpssterlhlyqiwimpeengitpryeqrrfdav qgkqlvlspdardgslkvhqdmelyrwallkdeqsvhqiaaerrvwiqvvkgnvtingvkastsdglai wdeqaisihadsdsevllfdlppv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.76 Rfree 0.2503
    Matthews' coefficent 2.00 Rfactor 0.1972
    Waters 142 Solvent Content 37.00

    Ligand Information
    Metals CD (CADMIUM) x 6


    Google Scholar output for 1tq5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch