The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of YaeO, a Rho-specific Inhibitor of Transcription Termination. J.Biol.Chem. 282 23348-23353 2007
    Site BSGI
    PDB Id 1sg5 Target Id ROF_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11963, Molecular Weight 9479.14 Da.
    Residues 84 Isoelectric Point 4.63
    Sequence mndtyqpincddydnlelacqhhlmltlelkdgeklqakasdlvsrknveylvveaagetrelrldkit sfshpeigtvvvses
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 1sg5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch