.
The Open Protein Structure Annotation Network
PDB Keyword
.

1q18

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of Escherichia coli ATP-dependent glucokinase and its complex with glucose. J.Bacteriol. 186 6915-6927 2004
    Site BSGI
    PDB Id 1q18 Target Id GLK_ECO57
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS11986, Molecular Weight 34721.16 Da.
    Residues 321 Isoelectric Point 6.06
    Sequence mtkyalvgdvggtnarlalcdiasgeisqaktysgldypsleavirvyleehkvevkdgciaiacpitg dwvamtnhtwafsiaemkknlgfshleiindftavsmaipmlkkehliqfggaepvegkpiavygagtg lgvahlvhvdkrwvslpgegghvdfapnseeeaiileilraeighvsaervlsgpglvnlyraivkadn rlpenlkpkditeraladsctdcrralslfcvimgrfggnlalnlgtfggvfiaggivprfleffkasg fraafedkgrfkeyvhdipvylivhdnpgllgsgahlrqtlghil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.36 Rfree 0.267
    Matthews' coefficent 2.69 Rfactor 0.20619
    Waters 387 Solvent Content 54.19

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1q18

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch