.
The Open Protein Structure Annotation Network
PDB Keyword
.

1o9b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structures of Shikimate Dehydrogenase Aroe and its Paralog Ydib: A Common Structural Framework for Different Activities. J.Biol.Chem. 278 19463 2003
    Site BSGI
    PDB Id 1o9b Target Id YDIB_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11970, Molecular Weight 31226.14 Da.
    Residues 288 Isoelectric Point 5.03
    Sequence mdvtakyeliglmaypirhslspemqnkalekaglpftymafevdndsfpgaieglkalkmrgtgvsmp nkqlaceyvdeltpaaklvgaintivnddgylrgyntdgtghiraikesgfdikgktmvllgaggasta igaqgaieglkeiklfnrrdeffdkalafaqrvnentdcvvtvtdladqqafaealasadiltngtkvg mkpleneslvndisllhpgllvtecvynphmtkllqqaqqagcktidgygmllwqgaeqftlwtgkdfp leyvkqvmgfga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.5 Rfree 0.294
    Matthews' coefficent 2.305 Rfactor 0.226
    Waters 154 Solvent Content 45

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 2;PO4 (PHOSPHATE) x 5
    Metals

    Jmol

     
    Google Scholar output for 1o9b

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch