.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nt4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional insights revealed by the crystal structures of Escherichia coli glucose-1-phosphatase. J.Biol.Chem. 278 31412-31418 2003
    Site BSGI
    PDB Id 1nt4 Target Id AGP_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11933, Molecular Weight 45680.56 Da.
    Residues 413 Isoelectric Point 5.48
    Sequence mnktliaaavagivllasnaqaqtvpegyqlqqvlmmsrhnlraplanngsvleqstpnkwpewdvpgg qlttkggvlevymghymrewlaeqgmvksgecpppytvyayanslqrtvataqffitgafpgcdipvhh qekmgtmdptfnpvitddsaafseqavaamekelsklqltdsyqllekivnykdspackekqqcslvdg kntfsakyqqepgvsgplkvgnslvdaftlqyyegfpmdqvawgeiksdqqwkvlsklkngyqdslfts pevarnvakplvsyidkalvtdrtsapkitvlvghdsniaslltaldfkpyqlhdqnertpiggkivfq rwhdskanrdlmkieyvyqsaeqlrnadaltlqapaqrvtlelsgcpidadgfcpmdkfdsvlneavk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.284
    Matthews' coefficent 2.28 Rfactor 0.218
    Waters 351 Solvent Content 46.07

    Ligand Information
    Ligands G1P (ALPHA-D-GLUCOSE-1-PHOSPHATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1nt4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch