The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Trimeric Form of Dephosphocoenzyme A Kinase from Escherichia coli. Protein Sci. 12 327-336 2003
    Site BSGI
    PDB Id 1n3b Target Id COAE_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11967, Molecular Weight 22620.48 Da.
    Residues 206 Isoelectric Point 5.77
    Sequence mryivaltggigsgkstvanafadlginvidadiiarqvvepgapalhaiadhfganmiaadgtlqrra lrerifanpeeknwlnallhpliqqetqhqiqqatspyvlwvvpllvenslykkanrvlvvdvspetql krtmqrddvtrehveqilaaqatrearlavaddvidnngapdaiasdvarlhahylqlasqfvsqekp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.246
    Matthews' coefficent 2.45 Rfactor 0.217
    Waters 449 Solvent Content 49.44

    Ligand Information
    Ligands SO4 (SULFATE) x 10


    Google Scholar output for 1n3b

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch