.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kon

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title UNPUBLISHED. TO BE PUBLISHED
    Site BSGI
    PDB Id 1kon Target Id YEBC_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11971, Molecular Weight 26421.06 Da.
    Residues 246 Isoelectric Point 4.71
    Sequence maghskwantrhrkaaqdakrgkiftkiirelvtaaklgggdpdanprlraavdkalsnnmtrdtlnra iargvggdddanmetiiyegygpggtaimieclsdnrnrtvaevrhafskcggnlgtdgsvaylfskkg visfekgdedtimeaaleagaedvvtyddgaidvytaweemgkvrdaleaaglkadsaevsmipstkad mdaetapklmrlidmledcddvqevyhngeisdevaatl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.3170000
    Matthews' coefficent 2.11 Rfactor 0.2730000
    Waters Solvent Content 41.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1kon

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch