.
The Open Protein Structure Annotation Network
PDB Keyword
.

1fc4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three-dimensional structure of 2-amino-3-ketobutyrate CoA ligase from Escherichia coli complexed with a PLP-substrate intermediate: inferred reaction mechanism. Biochemistry 40 5151-5160 2001
    Site BSGI
    PDB Id 1fc4 Target Id KBL_ECOLI
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS11941, Molecular Weight 43114.64 Da.
    Residues 398 Isoelectric Point 5.64
    Sequence mrgefyqqltndletaraeglfkeeriitsaqqaditvadgshvinfcannylglanhpdliaaakagm dshgfgmasvrficgtqdshkeleqklaaflgmedailysscfdangglfetllgaedaiisdalnhas iidgvrlckakryryanndmqelearlkeareagarhvliatdgvfsmdgvianlkgvcdladkydalv mvddshavgfvgengrgsheycdvmgrvdiitgtlgkalggasggytaarkevvewlrqrsrpylfsns lapaivaasikvlemveagselrdrlwanarqfreqmsaagftlagadhaiipvmlgdavvaqkfarel qkegiyvtgffypvvpkgqarirtqmsaahtpeqitraveaftrigkqlgvia
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.212
    Matthews' coefficent 2.13 Rfactor 0.151
    Waters 1103 Solvent Content 42.15

    Ligand Information
    Ligands AKB-PLP (2-AMINO-3-KETOBUTYRIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 1fc4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch