.
The Open Protein Structure Annotation Network
PDB Keyword
.

2i1l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the C2 form of FAD synthetase from Thermotoga maritima. To be Published
    Site BSGC
    PDB Id 2i1l Target Id BSGCAIR30409
    Related PDB Ids 1mrz 1s4m 1t6x 1t6y 1t6z 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8664, Molecular Weight 33612.10 Da.
    Residues 293 Isoelectric Point 8.77
    Sequence mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrvemlsryart vvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgvevyeiedvvvqgkrvsss lirnlvqegrveeipaylgryfeiegivhkdrefgrklgfptanidrgneklvdlkrgvylvrvhlpdg kkkfgvmnvgfrptvgdarnvkyevyildfegdlygqrlklevlkfmrdekkfdsieelkaaidqdvks arnmiddiinskfekeg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.281
    Matthews' coefficent 2.61 Rfactor 0.238
    Waters 83 Solvent Content 52.93

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2i1l

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch