The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of nicotinate-nucleotide pyrophosphorylase from Pyrococcus furiosus. To be Published
    Site BSGC
    PDB Id 2i14 Target Id BSGCAIR30636
    Molecular Characteristics
    Source Pyrococcus furiosus dsm 3638
    Alias Ids TPS8712, Molecular Weight 43365.31 Da.
    Residues 389 Isoelectric Point 7.03
    Sequence mkrfyianedeikagkttdvyflrtkkilevknirkkvladvtttslpnnwrwgvlvgveevakllegi pvnvyampegtifhpyepvlqiegdyadfgiyetallgmlsqasgiataalrikiaakfkpvysfgirh mhpaiapmidraafiggcdgvsgvlgaemmgekavgtmphaliitvgdqvkawkyfdevieeevprial vdtfydekveavmaaealgkklfavrldtpssrrgnfrkiieevrwelkvrgydwvkifvsggldeeki keivdvvdafgvggaiasakpvdfaldivevegkpiakrgklsgrkqvyrcenghyhvvpankklercp vcnakvepllkpiiengeivvefpkareireyvleqakkfnlei
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.90 Rfree 0.282
    Matthews' coefficent 2.45 Rfactor 0.247
    Waters 65 Solvent Content 49.86

    Ligand Information
    Metals ZN (ZINC) x 12


    Google Scholar output for 2i14

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch