The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of eukaryotic translation initiation factor 5A from Methanococcus jannaschii at 1.8 A resolution. Proc.Natl.Acad.Sci.USA 95 10419-10424 1998
    Site BSGC
    PDB Id 2eif Target Id BSGCAIR30508
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8686, Molecular Weight 14178.94 Da.
    Residues 132 Isoelectric Point 5.88
    Sequence mpgtkqvnvgslkvgqyvmidgvpceivdisvskpgkhggakarvvgigifekvkkefvaptsskvevp iidrrkgqvlaimgdmvqimdlqtyetlelpipegieglepggeveyieavgqykitrviggk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.249
    Matthews' coefficent 2.22 Rfactor 0.214
    Waters 108 Solvent Content 45.00

    Ligand Information


    Google Scholar output for 2eif

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch