The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structures of an NAD Kinase from Archaeoglobus fulgidus in Complex with ATP, NAD, or NADP. J.Mol.Biol. 354 289-303 2005
    Site BSGC
    PDB Id 1z0s Target Id BSGCAIR30424
    Related PDB Ids 1suw 1z0u 1z0z 
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8672, Molecular Weight 27866.95 Da.
    Residues 249 Isoelectric Point 6.25
    Sequence mraavvyktdghvkrieealkrlevevelfnqpseelenfdfivsvggdgtilrilqklkrcppifgin tgrvgllthaspenfevelkkavekfeverfprvscsampdvlalneiavlsrkpakmidvalrvdgve vdrircdgfivatqigstgyafsaggpvvepylecfilipiapfrfgwkpyvvsmerkieviaekaivv adgqksvdfdgeitieksefpavffknekrfrnlfgkvrsig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.2306
    Matthews' coefficent 2.00 Rfactor 0.1999
    Waters 407 Solvent Content 36.70

    Ligand Information
    Metals MG (MAGNESIUM) x 4


    Google Scholar output for 1z0s

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch