.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ytd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a nicotinate phosphoribosyltransferase from Thermoplasma acidophilum. J.Biol.Chem. 280 18326-18335 2005
    Site BSGC
    PDB Id 1ytd Target Id BSGCAIR30619
    Related PDB Ids 1yte 1ytk 2i1o 
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS8708, Molecular Weight 43294.38 Da.
    Residues 392 Isoelectric Point 6.20
    Sequence mnvfntasdedikkglasdvyfertisaigdkcndlrvameatvsgpldtwinftgldevlkllegldv dlyaipegtilfprdanglpvpfirvegrycdfgmyetailgficqasgistkaskvrlaagdspffsf girrmhpaispmidrsayiggadgvsgilgaklidqdpvgtmphalsimlgdeeawkltlentkngqks vllidtymdekfaaikiaemfdkvdyirldtpssrrgnfealirevrwelalrgrsdikimvsgglden tvkklreagaeafgvgtsissakpfdfamdivevngkpetkrgkmsgrknvlrctschrievvpanvqe ktcicggsmqnllvkylshgkrtseyprpkeirsrsmkeleyfkdis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.246
    Matthews' coefficent 3.69 Rfactor 0.198
    Waters 39 Solvent Content 65.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ytd

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch