The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a NAD kinase from Thermotoga maritima at 2.3 A resolution. Acta Crystallogr.,Sect.F 61 640-646 2005
    Site BSGC
    PDB Id 1yt5 Target Id BSGCAIR30585
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8701, Molecular Weight 29240.05 Da.
    Residues 258 Isoelectric Point 5.48
    Sequence mkiailyreerekegeflkekiskeheviefgeanapgrvtadlivvvggdgtvlkaakkaadgtpmvg fkagrlgfltsytldeidrfledlrnwnfreetrwfiqieselgnhlalndvtlerdlsgkmveievev ehhssmwffadgvvistptgstayslsiggpiifpecevleispiapqffltrsvvipsnfkvvvesqr dinmlvdgvltgktkrievkksrryvrilrppeydyvtvirdklgygrrie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.28
    Matthews' coefficent 2.24 Rfactor 0.213
    Waters 120 Solvent Content 30.00

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands SO4 (SULFATE) x 18


    Google Scholar output for 1yt5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch