.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yf2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of DNA sequence specificity subunit of a type I restriction-modification enzyme and its functional implications. Proc.Natl.Acad.Sci.USA 102 3248-3253 2005
    Site BSGC
    PDB Id 1yf2 Target Id BSGCAIR30591
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8702, Molecular Weight 48565.14 Da.
    Residues 425 Isoelectric Point 9.30
    Sequence mfykeenfkkteigeipedweivelkdvckkikaggtpktsveeyykngtipfvkieditnsnkyltnt kikiteeglnnsnawivpknsvlfamygsigetainkievatnqailgiipkdnileseflyyilaknk nyysklgmqttqknlnaqivksfkiplppleeqkqiakiltkidegieiieksinklerikkglmhkll tkgighsrfkkseigeipedwevfeikdifevktgttpstkkseywengeinwitpldlsrlnekiyig sserkvtkialekcnlnlipkgsiiistrapvgyvavltvestfnqgckglfqknndsvntefyayylk fkknllenlsggstfkelsksmlenfkiplppleeqkqiakilssvdksielkkqkkeklqrmkkkime llltgkvrvkt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.279
    Matthews' coefficent 3.74 Rfactor 0.236
    Waters 329 Solvent Content 66.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yf2

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch