.
The Open Protein Structure Annotation Network
PDB Keyword
.

1td9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structures of a phosphotransacetylase from Bacillus subtilis and its complex with acetyl phosphate. J.STRUCT.FUNCT.GENOM. 6 269-279 2005
    Site BSGC
    PDB Id 1td9 Target Id BSGCAIR30616
    Related PDB Ids 1xco 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS8706, Molecular Weight 34788.73 Da.
    Residues 323 Isoelectric Point 4.84
    Sequence madlfstvqekvagkdvkivfpeglderileavsklagnkvlnpivigneneiqakakelnltlggvki ydphtyegmedlvqafverrkgkateeqarkalldenyfgtmlvykgladglvsgaahstadtvrpalq iiktkegvkktsgvfimargeeqyvfadcainiapdsqdlaeiaiesantakmfdieprvamlsfstkg saksdetekvadavkiakekapeltldgefqfdaafvpsvaekkapdseikgdanvfvfpsleagnigy kiaqrlgnfeavgpilqglnmpvndlsrgcnaedvynlalitaaqal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.75 Rfree 0.297
    Matthews' coefficent 3.08 Rfactor 0.268
    Waters 114 Solvent Content 60.00

    Ligand Information
    Ligands SO4 (SULFATE) x 24
    Metals

    Jmol

     
    Google Scholar output for 1td9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch