.
The Open Protein Structure Annotation Network
PDB Keyword
.

1td6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the conserved hypothetical protein MPN330 (GI: 1674200) from Mycoplasma pneumoniae. Proteins 58 504-508 2004
    Site BSGC
    PDB Id 1td6 Target Id BSGCAIR30529
    Molecular Characteristics
    Source Mycoplasma pneumoniae
    Alias Ids TPS8693, Molecular Weight 34133.68 Da.
    Residues 294 Isoelectric Point 5.82
    Sequence minkpnqfvnhlsalkkhfasykelreafndyhkhngdelttfflhqfdkvmelvkqkdfktaqsrcee elaapylpkplvsffqsllqlvnhdlleqqnaalaslpaakiielvlqdypnklnmihyllpktkafvk phllqrlqfvltdsellelkrfsffqalnqipgfqgeqveyfnsklkqkftltlgefeiaqqpdakayf eqlitqiqqlflkepvnaefaneiidaflvsyfplhppvplaqlaakiyeyvsqivlneavnlkdelik livhtlyeqldrpvgden
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.298
    Matthews' coefficent 2.96 Rfactor 0.244
    Waters 50 Solvent Content 58.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1td6

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch