The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the putative DNA-binding protein SP_1288 from Streptococcus pyogenes. Acta Crystallogr.,Sect.D 60 1266-1271 2004
    Site BSGC
    PDB Id 1s7o Target Id BSGCAIR30594
    Molecular Characteristics
    Source Streptococcus pyogenes
    Alias Ids TPS8705, Molecular Weight 13589.62 Da.
    Residues 113 Isoelectric Point 4.52
    Sequence mnimeiektnrmnalfefyaalltdkqmnyielyyaddyslaeiadefgvsrqavydnikrtekilety emklhmysdyvvrseifddmiahyphdeylqekisiltsidnre
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.31 Rfree 0.23686
    Matthews' coefficent 3.19 Rfactor 0.20651
    Waters 103 Solvent Content 61.17

    Ligand Information


    Google Scholar output for 1s7o

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch