The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of MES buffer bound form of glyceraldehyde 3-phosphate dehydrogenase from Escherichia coli. To be Published
    Site BSGC
    PDB Id 1s7c Target Id BSGCAIR30560
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS8696, Molecular Weight 35530.59 Da.
    Residues 331 Isoelectric Point 6.61
    Sequence mtikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevkdghlivng kkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtgpskdntpmfvkganfdk yagqdivsnascttnclaplakvindnfgiieglmttvhattatqktvdgpshkdwrggrgasqniips stgaakavgkvlpelngkltgmafrvptpnvsvvdltvrlekaatyeqikaavkaaaegemkgvlgyte ddvvstdfngevctsvfdakagialndnfvklvswydnetgysnkvldliahisk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.22
    Matthews' coefficent 4.10 Rfactor 0.2
    Waters 106 Solvent Content 69.74

    Ligand Information


    Google Scholar output for 1s7c

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch