.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rq0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analyses of peptide release factor 1 from Thermotoga maritima reveal domain flexibility required for its interaction with the ribosome. J.Mol.Biol. 341 227-239 2004
    Site BSGC
    PDB Id 1rq0 Target Id BSGCAIR30383
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8531, Molecular Weight 39654.80 Da.
    Residues 342 Isoelectric Point 5.35
    Sequence mkekkkeiekllarpdltpeqmknygmeyakieeienitnriketqefiellreegeneleiekyekel dqlyqellfllspeasdkaiveirpgtggeeaalfardlfrmytryaerkgwnlevaeihetdlggire vvffvkgknaygilkyesgvhrvqrvpvtesggrihtstatvavlpeieekdieirpedlkietfrasg hggqyvnktesavrithlptgivvscqnersqyqnkqtalrilrarlyqlqkeqkereisqkrksqigt gersekirtynfpqnrvtdhrinytsyrlqeildgdldeiiskliehdiennleevlgigasveek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.65 Rfree 0.294
    Matthews' coefficent 2.32 Rfactor 0.216
    Waters 204 Solvent Content 47.09

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1rq0

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch