The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a phosphotransacetylase from Streptococcus pyogenes. Proteins 55 479-481 2004
    Site BSGC
    PDB Id 1r5j Target Id BSGCAIR30593
    Molecular Characteristics
    Source Streptococcus pyogenes
    Alias Ids TPS8704, Molecular Weight 35822.00 Da.
    Residues 331 Isoelectric Point 5.01
    Sequence msirslfgglrekilgknmkivfpegndervvraaarlkfegllepiilgqseevrnlltklgfadqdy tiinpneyadfdkmkeafvevrkgkatledadkmlrdvnyfgvmlvkmgladgmvsgaihstadtvrpa lqiiktkpgisrtsgvflmnrentseryvfadcainidptaqelaeiavntaetakifdidpkiamlsf stkgsgkapqvdkvreateiatglnpdlaldgelqfdaafvpetaaikapdsavagqantfvfpdlqsg nigykiaqrlgmfdaigpilqglnkpvndlsrgssaediyklaiitaaqaiesqg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.281
    Matthews' coefficent 3.05 Rfactor 0.229
    Waters 30 Solvent Content 59.60

    Ligand Information


    Google Scholar output for 1r5j

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch