.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pa4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of a putative ribosome binding protein from Mycoplasma pneumoniae and comparison to a distant homolog. J.STRUCT.FUNCT.GENOM. 4 235-243 2003
    Site BSGC
    PDB Id 1pa4 Target Id BSGCAIR30410
    Molecular Characteristics
    Source Mycoplasma pneumoniae
    Alias Ids TPS8665, Molecular Weight 13388.82 Da.
    Residues 116 Isoelectric Point 9.41
    Sequence masykkerlendiirlinrtviheiynetvktghvthvklsddllhvtvyldcynreqidrvvgafnqa kgvfsrvlahnlylakavqihfvkdkaidnamriesiinslkkskpn
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1pa4

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch