.
The Open Protein Structure Annotation Network
PDB Keyword
.

1oz9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the hypothetical protein AQ_1354 from Aquifex aeolicus. Acta Crystallogr.,Sect.D 59 1219-1223 2003
    Site BSGC
    PDB Id 1oz9 Target Id BSGCAIR30418
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS8669, Molecular Weight 17337.10 Da.
    Residues 150 Isoelectric Point 9.13
    Sequence msstkrqknrvlvklkkrkvrkdkiekwaelalsalglnnvelsvyitddqeirelnktyrkkdkptdv lsfpmgeefggykilgdvvisqdtaerqarelghsleeevkrlivhgivhllgydhekggeeekkfrel enyvlsklskal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.89 Rfree 0.23423
    Matthews' coefficent 2.76 Rfactor 0.20524
    Waters 50 Solvent Content 55.07

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1oz9

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch