The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a phosphatase with a unique substrate binding domain from Thermotoga maritima. Protein Sci. 12 1464-1472 2003
    Site BSGC
    PDB Id 1nf2 Target Id BSGCAIR30381
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8489, Molecular Weight 31185.12 Da.
    Residues 268 Isoelectric Point 5.04
    Sequence myrvfvfdldgtllndnleisekdrrnieklsrkcyvvfasgrmlvstlnvekkyfkrtfptiayngai vylpeegvilnekippevakdiieyikplnvhwqayiddvlysekdneeiksyarhsnvdyrvepnlse lvskmgttklllidtperldelkeilserfkdvvkvfksfptyleivpknvdkgkalrflrermnwkke eivvfgdnendlfmfeeaglrvamenaiekvkeasdivtltnndsgvsyvleristdclde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.20 Rfree 0.263
    Matthews' coefficent 2.91 Rfactor 0.217
    Waters 494 Solvent Content 57.41

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals MG (MAGNESIUM) x 3


    Google Scholar output for 1nf2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch