.
The Open Protein Structure Annotation Network
PDB Keyword
.

1n0f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a protein associated with cell division from Mycoplasma pneumoniae (GI: 13508053): a novel fold with a conserved sequence motif. Proteins 55 785-791 2004
    Site BSGC
    PDB Id 1n0f Target Id BSGCAIR30390
    Related PDB Ids 1n0e 1n0g 
    Molecular Characteristics
    Source Mycoplasma pneumoniae
    Alias Ids TPS8577, Molecular Weight 16333.85 Da.
    Residues 141 Isoelectric Point 5.88
    Sequence mllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfnsfpstqkdtrtlk rlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwdkklyedylansesletvaermk dvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.80 Rfree 0.284
    Matthews' coefficent 2.35 Rfactor 0.24
    Waters 184 Solvent Content 47.57

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1n0f

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch