The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure-based assignment of the biochemical function of a hypothetical protein: a test case of structural genomics. Proc.Natl.Acad.Sci.USA 95 15189-15193 1998
    Site BSGC
    PDB Id 1mjh Target Id BSGCAIR30507
    Molecular Characteristics
    Source Methanococcus jannaschii
    Alias Ids TPS8685, Molecular Weight 18337.63 Da.
    Residues 162 Isoelectric Point 6.93
    Sequence msvmykkilyptdfsetaeialkhvkafktlkaeevillhvidereikkrdifslllgvaglnksveef enelknklteeaknkmenikkeledvgfkvkdiivvgipheeivkiaedegvdiiimgshgktnlkeil lgsvtenvikksnkpvlvvkrkns
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.254
    Matthews' coefficent 2.34 Rfactor 0.21
    Waters 284 Solvent Content 47.48

    Ligand Information
    Metals MN (MANGANESE) x 2


    Google Scholar output for 1mjh

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch