The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical protein, TM841 of Thermotoga maritima, reveals its function as fatty acid binding protein. Proteins 50 526-530 2003
    Site BSGC
    PDB Id 1mgp Target Id BSGCAIR30341
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8326, Molecular Weight 32572.90 Da.
    Residues 288 Isoelectric Point 5.86
    Sequence mkvkilvdstadvpfswmekydidsiplyvvwedgrsepderepeeimnfykrireagsvpktsqpsve dfkkrylkykeedydvvlvltlssklsgtynsavlaskevdipvyvvdtllasgaiplparvaremlen gatieevlkkldermknkdfkaifyvsnfdylvkggrvskfqgfvgnllkirvclhiengelipyrkvr gdkkaiealieklredtpegsklrvigvhadneagvvellntlrksyevvdeiispmgkvitthvgpgt vgfgievlerkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.228
    Matthews' coefficent 2.42 Rfactor 0.202
    Waters 224 Solvent Content 49.24

    Ligand Information
    Ligands PLM (PALMITIC) x 1


    Google Scholar output for 1mgp

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch