.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lql

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a stress inducible protein from Mycoplasma pneumoniae at 2.85 A resolution. J.STRUCT.FUNCT.GENOM. 4 31-34 2003
    Site BSGC
    PDB Id 1lql Target Id BSGCAIR30348
    Molecular Characteristics
    Source Mycoplasma pneumoniae
    Alias Ids TPS8327, Molecular Weight 15467.91 Da.
    Residues 141 Isoelectric Point 6.50
    Sequence mdkkyditavlnedssmtaisdqfqitldarpkhtakgfgplaallsglaacelatanlmapakmitin kllmnvtgsrstnptdgyfglreinlhweihspnseteikefidfvskrcpahntlqgvsqlkinvnvt lvh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.85 Rfree 0.276
    Matthews' coefficent 2.70 Rfactor 0.217
    Waters 219 Solvent Content 53.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1lql

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch