.
The Open Protein Structure Annotation Network
PDB Keyword
.

1l2f

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of NusA from Thermotoga maritima and functional implication of the N-terminal domain. Biochemistry 42 13429-13437 2003
    Site BSGC
    PDB Id 1l2f Target Id BSGCAIR30412
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS8666, Molecular Weight 37918.31 Da.
    Residues 344 Isoelectric Point 6.61
    Sequence mnigllealdqleeekgiskeevipilekalvsayrknfgnsknvevvidrntgnikvyqllevveeve dpatqisleeakkidplaevgsivkkelnvknfgriaaqtakqvliqrirelekekqfekyselkgtvt taevirvmgewadirigkletrlpkkewipgeeikagdlvkvyiidvvkttkgpkilvsrrvpefvigl mkleipevengiveikaiarepgvrtkvavasndpnvdpigacigeggsriaailkelkgekldvlkws ddpkqlianalapatvieveildkenkaarvlvpptqlslaigkggqnarlaakltgwkidikpimnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.298
    Matthews' coefficent 2.65 Rfactor 0.223
    Waters 219 Solvent Content 53.58

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1l2f

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch