.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jx7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a conserved hypothetical protein from Escherichia coli. J.STRUCT.FUNCT.GENOM. 2 53-66 2002
    Site BSGC
    PDB Id 1jx7 Target Id BSGCAIR30513
    Molecular Characteristics
    Source Escherichia coli o157:h7
    Alias Ids TPS8691, Molecular Weight 12692.04 Da.
    Residues 117 Isoelectric Point 5.02
    Sequence mqkivivangapygseslfnslrlaialreqesnldlrlflmsdavtaglrgqkpgegyniqqmleilt aqnvpvklcktctdgrgistlplidgveigtlvelaqwtlsadkvltf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.80 Rfree 0.2650000
    Matthews' coefficent 2.42 Rfactor 0.2290000
    Waters 86 Solvent Content 49.20

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1jx7

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch